Lineage for d1rjza2 (1rjz A:1-181)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries)
    Uniprot P01901 22-299
  8. Domain d1rjza2: 1rjz A:1-181 [111843]
    Other proteins in same PDB: d1rjza1, d1rjzb1, d1rjzb2, d1rjzd1, d1rjze1, d1rjze2
    mutant

Details for d1rjza2

PDB Entry: 1rjz (more details), 2.6 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpies simplex virus mutant glycoprotein b peptide
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1rjza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjza2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOPe Domain Coordinates for d1rjza2 are not available.

Timeline for d1rjza2:

Domains from same chain:
(mouse over for more information)
d1rjza1
Domains from other chains:
(mouse over for more information)
d1rjzb1, d1rjzb2, d1rjzd1, d1rjzd2, d1rjze1, d1rjze2