SCOP 1.73: Domain d1rjza1: 1rjz A:182-278

Lineage for d1rjza1 (1rjz A:182-278)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries)

8. Domain d1rjza1: 1rjz A:182-278 [111842]
   Other proteins in same PDB: d1rjza2, d1rjzb_, d1rjzd2, d1rjze_

Details for d1rjza1

PDB Entry: 1rjz, 2.6 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpies simplex virus mutant glycoprotein b peptide

PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOP Domain Sequences for d1rjza1:

Sequence; same for both SEQRES and ATOM records:

>d1rjza1 b.1.1.2 (A:182-278) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrweppp

Timeline for d1rjza1:

• d1rjza1 first appeared in SCOP 1.71
  
• d1rjza1 appears in SCOP 1.75
  
• d1rjza1 appears in the current release, SCOPe 2.08