![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Class I MHC, alpha-3 domain [88604] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88606] (66 PDB entries) |
![]() | Domain d1rjza1: 1rjz A:182-278 [111842] Other proteins in same PDB: d1rjza2, d1rjzb_, d1rjzd2, d1rjze_ |
PDB Entry: 1rjz (more details), 2.6 Å
SCOP Domain Sequences for d1rjza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rjza1 b.1.1.2 (A:182-278) Class I MHC, alpha-3 domain {Mouse (Mus musculus)} tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf qkwasvvvplgkeqyytchvyhqglpepltlrweppp
Timeline for d1rjza1:
![]() Domains from other chains: (mouse over for more information) d1rjzb_, d1rjzd1, d1rjzd2, d1rjze_ |