![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (7 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries) Uniprot P01887 |
![]() | Domain d1rjye1: 1rjy E:1-99 [111841] Other proteins in same PDB: d1rjya1, d1rjya2, d1rjyb2, d1rjyd1, d1rjyd2, d1rjye2 mutant |
PDB Entry: 1rjy (more details), 1.9 Å
SCOPe Domain Sequences for d1rjye1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rjye1 b.1.1.2 (E:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1rjye1: