SCOPe 2.06: Domain d1rjye1: 1rjy E:1-99

Lineage for d1rjye1 (1rjy E:1-99)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein beta2-microglobulin [88600] (6 species)
Species Mouse (Mus musculus) [TaxId:10090] [88603] (182 PDB entries)
Uniprot P01887
Domain d1rjye1: 1rjy E:1-99 [111841]
Other proteins in same PDB: d1rjya1, d1rjya2, d1rjyb2, d1rjyd1, d1rjyd2, d1rjye2
mutant

Details for d1rjye1

PDB Entry: 1rjy (more details), 1.9 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpes simplex virus glycoprotein b peptide

PDB Compounds: (E:) Beta-2-microglobulin

SCOPe Domain Sequences for d1rjye1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjye1 b.1.1.2 (E:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1rjye1:

Click to download the PDB-style file with coordinates for d1rjye1.
(The format of our PDB-style files is described here.)

Timeline for d1rjye1: