Lineage for d1rjyb_ (1rjy B:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein beta2-microglobulin [88600] (5 species) 
Species Mouse (Mus musculus) [TaxId:10090] [88603] (174 PDB entries)
Uniprot P01887
Domain d1rjyb_: 1rjy B: [111838]
Other proteins in same PDB: d1rjya1, d1rjya2, d1rjyd1, d1rjyd2
mutant
Details for d1rjyb_
PDB Entry: 1rjy (more details), 1.9 Å
PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpes simplex virus glycoprotein b peptide
PDB Compounds: (B:) Beta-2-microglobulinSCOPe Domain Sequences for d1rjyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rjyb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
SCOPe Domain Coordinates for d1rjyb_:
Click to download the PDB-style file with coordinates for d1rjyb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rjyb_:
- d1rjyb_ first appeared in SCOP 1.71
- d1rjyb_ appears in SCOPe 2.04
- d1rjyb_ is called d1rjyb1 in SCOPe 2.06
- d1rjyb_ appears in the current release, SCOPe 2.08, called d1rjyb1
View in 3D
