Lineage for d1rjyb1 (1rjy B:1-99)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2020525Protein beta2-microglobulin [88600] (5 species)
  7. 2021164Species Mouse (Mus musculus) [TaxId:10090] [88603] (175 PDB entries)
    Uniprot P01887
  8. 2021206Domain d1rjyb1: 1rjy B:1-99 [111838]
    Other proteins in same PDB: d1rjya1, d1rjya2, d1rjyb2, d1rjyd1, d1rjyd2, d1rjye2
    mutant

Details for d1rjyb1

PDB Entry: 1rjy (more details), 1.9 Å

PDB Description: Mhc Class I Natural Mutant H-2Kbm8 Heavy Chain Complexed With beta-2 Microglobulin and Herpes Simplex Virus Glycoprotein B Peptide
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1rjyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjyb1 b.1.1.2 (B:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1rjyb1:

Click to download the PDB-style file with coordinates for d1rjyb1.
(The format of our PDB-style files is described here.)

Timeline for d1rjyb1: