SCOPe 2.08: Domain d1rjyb1: 1rjy B:1-99

Lineage for d1rjyb1 (1rjy B:1-99)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
   Uniprot P01887

8. Domain d1rjyb1: 1rjy B:1-99 [111838]
   Other proteins in same PDB: d1rjya1, d1rjya2, d1rjyb2, d1rjyd1, d1rjyd2, d1rjye2
   mutant

Details for d1rjyb1

PDB Entry: 1rjy, 1.9 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpes simplex virus glycoprotein b peptide

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1rjyb1:

Sequence; same for both SEQRES and ATOM records:

>d1rjyb1 b.1.1.2 (B:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1rjyb1:

• d1rjyb1 first appeared in SCOP 1.71, called d1rjyb_
  
• d1rjyb1 appears in SCOPe 2.07