SCOP 1.73: Domain d1rjya1: 1rjy A:182-278

Lineage for d1rjya1 (1rjy A:182-278)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries)

8. Domain d1rjya1: 1rjy A:182-278 [111836]
   Other proteins in same PDB: d1rjya2, d1rjyb_, d1rjyd2, d1rjye_

Details for d1rjya1

PDB Entry: 1rjy, 1.9 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpes simplex virus glycoprotein b peptide

PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOP Domain Sequences for d1rjya1:

Sequence; same for both SEQRES and ATOM records:

>d1rjya1 b.1.1.2 (A:182-278) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrweppp

Timeline for d1rjya1:

• d1rjya1 first appeared in SCOP 1.71
  
• d1rjya1 appears in SCOP 1.75
  
• d1rjya1 appears in the current release, SCOPe 2.08