Lineage for d1rjnb_ (1rjn B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461344Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2461519Protein Naphthoate synthase MenB [102208] (1 species)
  7. 2461520Species Mycobacterium tuberculosis [TaxId:1773] [102209] (4 PDB entries)
    Uniprot O06414 18-285
  8. 2461537Domain d1rjnb_: 1rjn B: [111830]
    complexed with coa, ep1

Details for d1rjnb_

PDB Entry: 1rjn (more details), 2.3 Å

PDB Description: the crystal structure of menb (rv0548c) from mycobacterium tuberculosis in complex with the coa portion of naphthoyl coa
PDB Compounds: (B:) menB

SCOPe Domain Sequences for d1rjnb_:

Sequence, based on SEQRES records: (download)

>d1rjnb_ c.14.1.3 (B:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]}
alsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvl
dharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasgdtadtvdvaragr
lhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyarfkqtdadvgsfdg
gygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaeletvglqwaaeinak
spqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdaflqkrppdwspfpry
f

Sequence, based on observed residues (ATOM records): (download)

>d1rjnb_ c.14.1.3 (B:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]}
alsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvl
dharmspdvgvvlltgngpspkdggwafcsggdqrhilevqrlirfmpkvviclvngwaa
ggghslhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrty
taeqmhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfa
geatrlaymtdeavegrdaflqkrppdwspfpryf

SCOPe Domain Coordinates for d1rjnb_:

Click to download the PDB-style file with coordinates for d1rjnb_.
(The format of our PDB-style files is described here.)

Timeline for d1rjnb_: