Lineage for d1rjna_ (1rjn A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690605Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 690606Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 690760Family c.14.1.3: Crotonase-like [52103] (13 proteins)
  6. 690888Protein Naphthoate synthase MenB [102208] (1 species)
  7. 690889Species Mycobacterium tuberculosis [TaxId:1773] [102209] (4 PDB entries)
  8. 690905Domain d1rjna_: 1rjn A: [111829]

Details for d1rjna_

PDB Entry: 1rjn (more details), 2.3 Å

PDB Description: The Crystal Structure of MenB (Rv0548c) from Mycobacterium tuberculosis in Complex with the CoA Portion of Naphthoyl CoA
PDB Compounds: (A:) menB

SCOP Domain Sequences for d1rjna_:

Sequence, based on SEQRES records: (download)

>d1rjna_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]}
dnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldha
rmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasgdtadtvdvaragrlhi
levqrlirfmpkvviclvngwaaggghslhvvcdltlasreyarfkqtdadvgsfdggyg
saylarqvgqkfareifflgrtytaeqmhqmgavnavaehaeletvglqwaaeinakspq
aqrmlkfafnllddglvgqqlfageatrlaymtdeavegr

Sequence, based on observed residues (ATOM records): (download)

>d1rjna_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]}
dnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldha
rmspdvgvvlltgngpspkdggwafcsggdqaragrlhilevqrlirfmpkvviclvngw
aaggghslhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgr
tytaeqmhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqql
fageatrlaymtdeavegr

SCOP Domain Coordinates for d1rjna_:

Click to download the PDB-style file with coordinates for d1rjna_.
(The format of our PDB-style files is described here.)

Timeline for d1rjna_: