Lineage for d1rjna_ (1rjn A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099550Family c.14.1.3: Crotonase-like [52103] (14 protein domains)
  6. 2099688Protein Naphthoate synthase MenB [102208] (1 species)
  7. 2099689Species Mycobacterium tuberculosis [TaxId:1773] [102209] (4 PDB entries)
    Uniprot O06414 18-285
  8. 2099705Domain d1rjna_: 1rjn A: [111829]
    complexed with coa, ep1

Details for d1rjna_

PDB Entry: 1rjn (more details), 2.3 Å

PDB Description: The Crystal Structure of MenB (Rv0548c) from Mycobacterium tuberculosis in Complex with the CoA Portion of Naphthoyl CoA
PDB Compounds: (A:) menB

SCOPe Domain Sequences for d1rjna_:

Sequence, based on SEQRES records: (download)

>d1rjna_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]}
dnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldha
rmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasgdtadtvdvaragrlhi
levqrlirfmpkvviclvngwaaggghslhvvcdltlasreyarfkqtdadvgsfdggyg
saylarqvgqkfareifflgrtytaeqmhqmgavnavaehaeletvglqwaaeinakspq
aqrmlkfafnllddglvgqqlfageatrlaymtdeavegr

Sequence, based on observed residues (ATOM records): (download)

>d1rjna_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]}
dnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldha
rmspdvgvvlltgngpspkdggwafcsggdqaragrlhilevqrlirfmpkvviclvngw
aaggghslhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgr
tytaeqmhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqql
fageatrlaymtdeavegr

SCOPe Domain Coordinates for d1rjna_:

Click to download the PDB-style file with coordinates for d1rjna_.
(The format of our PDB-style files is described here.)

Timeline for d1rjna_: