Lineage for d1rjmb_ (1rjm B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577845Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 577846Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 577900Family c.14.1.3: Crotonase-like [52103] (8 proteins)
  6. 577995Protein Naphthoate synthase MenB [102208] (1 species)
  7. 577996Species Mycobacterium tuberculosis [TaxId:1773] [102209] (4 PDB entries)
  8. 578010Domain d1rjmb_: 1rjm B: [111827]

Details for d1rjmb_

PDB Entry: 1rjm (more details), 2.15 Å

PDB Description: crystal structure of menb (rv0548c) from mycobacterium tuberculosis

SCOP Domain Sequences for d1rjmb_:

Sequence, based on SEQRES records: (download)

>d1rjmb_ c.14.1.3 (B:) Naphthoate synthase MenB {Mycobacterium tuberculosis}
dnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldha
rmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasgdtadtvdvaragrlhi
levqrlirfmpkvviclvngwaaggghslhvvcdltlasreyarfkqtdadvgsfdggyg
saylarqvgqkfareifflgrtytaeqmhqmgavnavaehaeletvglqwaaeinakspq
aqrmlkfafnllddglvgqqlfageatrl

Sequence, based on observed residues (ATOM records): (download)

>d1rjmb_ c.14.1.3 (B:) Naphthoate synthase MenB {Mycobacterium tuberculosis}
dnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldha
rmspdvgvvlltgngpspkdggwafcsgghilevqrlirfmpkvviclvngwaaggghsl
hvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmh
qmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrl

SCOP Domain Coordinates for d1rjmb_:

Click to download the PDB-style file with coordinates for d1rjmb_.
(The format of our PDB-style files is described here.)

Timeline for d1rjmb_: