Lineage for d1rjma_ (1rjm A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2112573Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2112711Protein Naphthoate synthase MenB [102208] (1 species)
  7. 2112712Species Mycobacterium tuberculosis [TaxId:1773] [102209] (4 PDB entries)
    Uniprot O06414 18-285
  8. 2112725Domain d1rjma_: 1rjm A: [111826]
    complexed with ep1

Details for d1rjma_

PDB Entry: 1rjm (more details), 2.15 Å

PDB Description: crystal structure of menb (rv0548c) from mycobacterium tuberculosis
PDB Compounds: (A:) menB

SCOPe Domain Sequences for d1rjma_:

Sequence, based on SEQRES records: (download)

>d1rjma_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]}
npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
mspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasgdtadtvdvaragrlhil
evqrlirfmpkvviclvngwaaggghslhvvcdltlasreyarfkqtdadvgsfdggygs
aylarqvgqkfareifflgrtytaeqmhqmgavnavaehaeletvglqwaaeinakspqa
qrmlkfafnllddglvgqqlfageatrl

Sequence, based on observed residues (ATOM records): (download)

>d1rjma_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]}
npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
mspdvgvvlltgngpspkdggwafcsgghilevqrlirfmpkvviclvngwaaggghslh
vvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhq
mgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrl

SCOPe Domain Coordinates for d1rjma_:

Click to download the PDB-style file with coordinates for d1rjma_.
(The format of our PDB-style files is described here.)

Timeline for d1rjma_: