Lineage for d1rjma_ (1rjm A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577845Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 577846Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 577900Family c.14.1.3: Crotonase-like [52103] (8 proteins)
  6. 577995Protein Naphthoate synthase MenB [102208] (1 species)
  7. 577996Species Mycobacterium tuberculosis [TaxId:1773] [102209] (4 PDB entries)
  8. 578009Domain d1rjma_: 1rjm A: [111826]

Details for d1rjma_

PDB Entry: 1rjm (more details), 2.15 Å

PDB Description: Crystal Structure of MenB (Rv0548c) from Mycobacterium tuberculosis

SCOP Domain Sequences for d1rjma_:

Sequence, based on SEQRES records: (download)

>d1rjma_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis}
npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
mspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasgdtadtvdvaragrlhil
evqrlirfmpkvviclvngwaaggghslhvvcdltlasreyarfkqtdadvgsfdggygs
aylarqvgqkfareifflgrtytaeqmhqmgavnavaehaeletvglqwaaeinakspqa
qrmlkfafnllddglvgqqlfageatrl

Sequence, based on observed residues (ATOM records): (download)

>d1rjma_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis}
npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
mspdvgvvlltgngpspkdggwafcsgghilevqrlirfmpkvviclvngwaaggghslh
vvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhq
mgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrl

SCOP Domain Coordinates for d1rjma_:

Click to download the PDB-style file with coordinates for d1rjma_.
(The format of our PDB-style files is described here.)

Timeline for d1rjma_: