Lineage for d1rjlb1 (1rjl B:1-120)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 546557Species Engineered (including hybrid species) [88562] (52 PDB entries)
  8. 546629Domain d1rjlb1: 1rjl B:1-120 [111823]
    Other proteins in same PDB: d1rjla1, d1rjla2, d1rjlb2, d1rjlc_
    MQ NA P01864 # artificial chimera

Details for d1rjlb1

PDB Entry: 1rjl (more details), 2.6 Å

PDB Description: Structure of the complex between OspB-CT and bactericidal Fab-H6831

SCOP Domain Sequences for d1rjlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjlb1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
qvqlqqpgsvlvrpgasvklsckasgftftsswmhwakqrpgqglewigeihpnsgnthy
nekfkgkatltvdtssstayvdlssltsedsavyycarmrygdyyamdnwgqgtsvtvss

SCOP Domain Coordinates for d1rjlb1:

Click to download the PDB-style file with coordinates for d1rjlb1.
(The format of our PDB-style files is described here.)

Timeline for d1rjlb1: