![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries) |
![]() | Domain d1rjla2: 1rjl A:108-212 [111822] Other proteins in same PDB: d1rjla1, d1rjlb1, d1rjlb2, d1rjlc_ MQ NA P01837 # artificial chimera |
PDB Entry: 1rjl (more details), 2.6 Å
SCOP Domain Sequences for d1rjla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rjla2 b.1.1.2 (A:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d1rjla2: