Lineage for d1rjla1 (1rjl A:1-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1511401Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511402Species Engineered (including hybrid species) [88533] (61 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. 1511483Domain d1rjla1: 1rjl A:1-107 [111821]
    Other proteins in same PDB: d1rjla2, d1rjlb1, d1rjlb2, d1rjlc_
    MQ NA P01837 # artificial chimera

Details for d1rjla1

PDB Entry: 1rjl (more details), 2.6 Å

PDB Description: Structure of the complex between OspB-CT and bactericidal Fab-H6831
PDB Compounds: (A:) Fab H6831 L-chain

SCOPe Domain Sequences for d1rjla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjla1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmnqspsslsaslgdtititchasqninvwlnwfqqkpgsipklliymasnlhtgvps
rfsgsgsgtgftltisslqpediatyycqqgqsfpltfgggtkleik

SCOPe Domain Coordinates for d1rjla1:

Click to download the PDB-style file with coordinates for d1rjla1.
(The format of our PDB-style files is described here.)

Timeline for d1rjla1: