Lineage for d1riya_ (1riy A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642646Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 642647Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (2 families) (S)
    dimer of identical subunits
  5. 642648Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins)
  6. 642649Protein HU protein [47735] (4 species)
  7. 642668Species Thermotoga maritima [TaxId:2336] [47737] (2 PDB entries)
  8. 642671Domain d1riya_: 1riy A: [111820]
    mutant

Details for d1riya_

PDB Entry: 1riy (more details), 1.8 Å

PDB Description: hu mutant v42i from thermotoga maritima
PDB Compounds: (A:) Hu DNA-binding protein

SCOP Domain Sequences for d1riya_:

Sequence, based on SEQRES records: (download)

>d1riya_ a.55.1.1 (A:) HU protein {Thermotoga maritima [TaxId: 2336]}
mnkkelidrvakkagakkkdvklildtiletitealakgekiqivgfgsfevrkaaarkg
vnpqtrkpitiperkvpkfkpgkalkekvk

Sequence, based on observed residues (ATOM records): (download)

>d1riya_ a.55.1.1 (A:) HU protein {Thermotoga maritima [TaxId: 2336]}
mnkkelidrvakkagakkkdvklildtiletitealakgekiqivgfgsfevrkrkvpkf
kpgkalkekvk

SCOP Domain Coordinates for d1riya_:

Click to download the PDB-style file with coordinates for d1riya_.
(The format of our PDB-style files is described here.)

Timeline for d1riya_: