Lineage for d1riya_ (1riy A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998362Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 1998363Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 1998364Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 protein domains)
    automatically mapped to Pfam PF00216
  6. 1998365Protein HU protein [47735] (5 species)
  7. 1998387Species Thermotoga maritima [TaxId:2336] [47737] (2 PDB entries)
    Uniprot P36206
  8. 1998390Domain d1riya_: 1riy A: [111820]
    mutant

Details for d1riya_

PDB Entry: 1riy (more details), 1.8 Å

PDB Description: HU mutant V42I from Thermotoga maritima
PDB Compounds: (A:) Hu DNA-binding protein

SCOPe Domain Sequences for d1riya_:

Sequence, based on SEQRES records: (download)

>d1riya_ a.55.1.1 (A:) HU protein {Thermotoga maritima [TaxId: 2336]}
mnkkelidrvakkagakkkdvklildtiletitealakgekiqivgfgsfevrkaaarkg
vnpqtrkpitiperkvpkfkpgkalkekvk

Sequence, based on observed residues (ATOM records): (download)

>d1riya_ a.55.1.1 (A:) HU protein {Thermotoga maritima [TaxId: 2336]}
mnkkelidrvakkagakkkdvklildtiletitealakgekiqivgfgsfevrkrkvpkf
kpgkalkekvk

SCOPe Domain Coordinates for d1riya_:

Click to download the PDB-style file with coordinates for d1riya_.
(The format of our PDB-style files is described here.)

Timeline for d1riya_: