Class a: All alpha proteins [46456] (290 folds) |
Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) dimer of identical subunits |
Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins) automatically mapped to Pfam PF00216 |
Protein HU protein [47735] (5 species) |
Species Thermotoga maritima [TaxId:2336] [47737] (2 PDB entries) Uniprot P36206 |
Domain d1riya_: 1riy A: [111820] mutant |
PDB Entry: 1riy (more details), 1.8 Å
SCOPe Domain Sequences for d1riya_:
Sequence, based on SEQRES records: (download)
>d1riya_ a.55.1.1 (A:) HU protein {Thermotoga maritima [TaxId: 2336]} mnkkelidrvakkagakkkdvklildtiletitealakgekiqivgfgsfevrkaaarkg vnpqtrkpitiperkvpkfkpgkalkekvk
>d1riya_ a.55.1.1 (A:) HU protein {Thermotoga maritima [TaxId: 2336]} mnkkelidrvakkagakkkdvklildtiletitealakgekiqivgfgsfevrkrkvpkf kpgkalkekvk
Timeline for d1riya_: