![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
![]() | Protein Thrombin [50531] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50532] (163 PDB entries) |
![]() | Domain d1riw.1: 1riw A:,B:,C: [111819] complexed with na, nag, osc, so4 |
PDB Entry: 1riw (more details), 2.04 Å
SCOP Domain Sequences for d1riw.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1riw.1 b.47.1.2 (A:,B:,C:) Thrombin {Human (Homo sapiens) [TaxId: 9606]} adcglrplfekksledkterellesyiXivegsdaeigmspwqvmlfrkspqellcgasl isdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihprynw renldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketXgqps vlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspfnnr wyqmgivswgegcdrdgkygfythvfrlkkwiqkvidq
Timeline for d1riw.1: