SCOP 1.73: Domain d1ritb_: 1rit B:

Lineage for d1ritb_ (1rit B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (23 PDB entries)

8. Domain d1ritb_: 1rit B: [111816]

Details for d1ritb_

PDB Entry: 1rit, 2.85 Å

PDB Description: crystal structure of peanut lectin in complex with meso- tetrasulphonatophenylporphyrin and lactose

PDB Compounds: (B:) Galactose-binding lectin

SCOP Domain Sequences for d1ritb_:

Sequence; same for both SEQRES and ATOM records:

>d1ritb_ b.29.1.1 (B:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

Timeline for d1ritb_:

• d1ritb_ first appeared in SCOP 1.71
  
• d1ritb_ appears in SCOP 1.75
  
• d1ritb_ appears in the current release, SCOPe 2.08