Lineage for d1rita_ (1rit A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. Protein Legume lectin [49904] (23 species)
  7. Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (30 PDB entries)
    Uniprot P02872 24-255
  8. Domain d1rita_: 1rit A: [111815]
    complexed with ca, mn, sfp

Details for d1rita_

PDB Entry: 1rit (more details), 2.8499999999999996 Å

PDB Description: crystal structure of peanut lectin in complex with meso- tetrasulphonatophenylporphyrin and lactose
PDB Compounds: (A:) Galactose-binding lectin

SCOPe Domain Sequences for d1rita_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rita_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOPe Domain Coordinates for d1rita_ are not available.

Timeline for d1rita_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ritb_, d1ritc_, d1ritd_