| Class b: All beta proteins [48724] (165 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) ![]() |
| Family b.29.1.1: Legume lectins [49900] (4 proteins) |
| Protein Legume lectin [49904] (23 species) |
| Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (23 PDB entries) |
| Domain d1rird_: 1rir D: [111814] complexed with ca, mn, sfp |
PDB Entry: 1rir (more details), 2.9 Å
SCOP Domain Sequences for d1rird_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rird_ b.29.1.1 (D:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
Timeline for d1rird_: