SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1rirc_ (1rir C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042364Protein Legume lectin [49904] (23 species)
  7. 2042540Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (24 PDB entries)
    Uniprot P02872 24-255
  8. 2042633Domain d1rirc_: 1rir C: [111813]
    complexed with ca, mn, sfp

Details for d1rirc_

PDB Entry: 1rir (more details), 2.9 Å

PDB Description: Crystal structure of meso-tetrasulphonatophenylporphyrin in complex with Peanut lectin.
PDB Compounds: (C:) Galactose-binding lectin

SCOPe Domain Sequences for d1rirc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rirc_ b.29.1.1 (C:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOPe Domain Coordinates for d1rirc_:

Click to download the PDB-style file with coordinates for d1rirc_.
(The format of our PDB-style files is described here.)

Timeline for d1rirc_: