Lineage for d1riib_ (1rii B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127984Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2127985Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2127986Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 protein domains)
  6. 2127996Protein Phosphoglycerate mutase [53256] (6 species)
  7. 2128033Species Mycobacterium tuberculosis [TaxId:1773] [117667] (1 PDB entry)
    Uniprot Q11140
  8. 2128035Domain d1riib_: 1rii B: [111808]
    Structural genomics target
    complexed with gol

Details for d1riib_

PDB Entry: 1rii (more details), 1.7 Å

PDB Description: crystal structure of phosphoglycerate mutase from m. tuberculosis
PDB Compounds: (B:) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase

SCOPe Domain Sequences for d1riib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1riib_ c.60.1.1 (B:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]}
ntgslvllrhgesdwnalnlftgwvdvgltdkgqaeavrsgeliaehdllpdvlytsllr
raittahlaldsadrlwipvrrswrlnerhygalqgldkaetkarygeeqfmawrrsydt
ppppiergsqfsqdadpryadigggpltecladvvarflpyftdvivgdlrvgktvliva
hgnslralvkhldqmsddeivglniptgiplrydldsamrplvrggtyldpeaaaag

SCOPe Domain Coordinates for d1riib_:

Click to download the PDB-style file with coordinates for d1riib_.
(The format of our PDB-style files is described here.)

Timeline for d1riib_: