![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
![]() | Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) ![]() |
![]() | Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) |
![]() | Protein Phosphoglycerate mutase [53256] (6 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [117667] (1 PDB entry) Uniprot Q11140 |
![]() | Domain d1riib_: 1rii B: [111808] Structural genomics target complexed with gol |
PDB Entry: 1rii (more details), 1.7 Å
SCOPe Domain Sequences for d1riib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1riib_ c.60.1.1 (B:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} ntgslvllrhgesdwnalnlftgwvdvgltdkgqaeavrsgeliaehdllpdvlytsllr raittahlaldsadrlwipvrrswrlnerhygalqgldkaetkarygeeqfmawrrsydt ppppiergsqfsqdadpryadigggpltecladvvarflpyftdvivgdlrvgktvliva hgnslralvkhldqmsddeivglniptgiplrydldsamrplvrggtyldpeaaaag
Timeline for d1riib_: