Lineage for d1ri0a_ (1ri0 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394116Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2394294Family b.34.9.2: PWWP domain [69250] (6 proteins)
    includes the C-terminal all-alpha subdomain
  6. 2394300Protein Hepatoma-derived growth factor, HDGF [117151] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [117152] (1 PDB entry)
    Uniprot P51858 1-100
  8. 2394302Domain d1ri0a_: 1ri0 A: [111806]

Details for d1ri0a_

PDB Entry: 1ri0 (more details)

PDB Description: nmr structure of the n-terminal hath domain of human hdgf
PDB Compounds: (A:) Hepatoma-derived growth factor

SCOPe Domain Sequences for d1ri0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ri0a_ b.34.9.2 (A:) Hepatoma-derived growth factor, HDGF {Human (Homo sapiens) [TaxId: 9606]}
msrsnrqkeykcgdlvfakmkgyphwparidempeaavkstankyqvfffgthetaflgp
kdlfpyeeskekfgkpnkrkgfseglweiennptvkasgy

SCOPe Domain Coordinates for d1ri0a_:

Click to download the PDB-style file with coordinates for d1ri0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ri0a_: