Lineage for d1rhxa_ (1rhx A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712706Fold c.114: DsrEFH-like [75168] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
  4. 712707Superfamily c.114.1: DsrEFH-like [75169] (2 families) (S)
  5. 712736Family c.114.1.2: DsrH-like [117489] (3 proteins)
    Pfam PF04077
  6. 712740Protein Hypothetical protein TM0979 [117490] (1 species)
  7. 712741Species Thermotoga maritima [TaxId:2336] [117491] (2 PDB entries)
  8. 712744Domain d1rhxa_: 1rhx A: [111805]
    Structural genomics target

Details for d1rhxa_

PDB Entry: 1rhx (more details)

PDB Description: high-resolution nmr structure of a putative sulfur transferase (tm0979) from thermotoga maritima
PDB Compounds: (A:) conserved hypothetical protein TM0979

SCOP Domain Sequences for d1rhxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhxa_ c.114.1.2 (A:) Hypothetical protein TM0979 {Thermotoga maritima [TaxId: 2336]}
malvlvkygtdhpveklkirsakaedkivliqngvfwaleeletpakvyaikddflargy
seedskvplitysefidllegeekfig

SCOP Domain Coordinates for d1rhxa_:

Click to download the PDB-style file with coordinates for d1rhxa_.
(The format of our PDB-style files is described here.)

Timeline for d1rhxa_: