SCOP 1.71: Domain d1rhxa_: 1rhx A:

Lineage for d1rhxa_ (1rhx A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.114: DsrEFH-like [75168] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215

4. Superfamily c.114.1: DsrEFH-like [75169] (2 families)

5. Family c.114.1.2: DsrH-like [117489] (1 protein)
   Pfam 04077

6. Protein Hypothetical protein TM0979 [117490] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [117491] (2 PDB entries)

8. Domain d1rhxa_: 1rhx A: [111805]
   Structural genomics target

Details for d1rhxa_

PDB Entry: 1rhx

PDB Description: high-resolution nmr structure of a putative sulfur transferase (tm0979) from thermotoga maritima

SCOP Domain Sequences for d1rhxa_:

Sequence; same for both SEQRES and ATOM records:

>d1rhxa_ c.114.1.2 (A:) Hypothetical protein TM0979 {Thermotoga maritima}
malvlvkygtdhpveklkirsakaedkivliqngvfwaleeletpakvyaikddflargy
seedskvplitysefidllegeekfig

Timeline for d1rhxa_:

• d1rhxa_ is new in SCOP 1.71
  
• d1rhxa_ appears in SCOP 1.73
  
• d1rhxa_ appears in the current release, SCOPe 2.08