![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.114: DsrEFH-like [75168] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215 |
![]() | Superfamily c.114.1: DsrEFH-like [75169] (3 families) ![]() |
![]() | Family c.114.1.2: DsrH-like [117489] (3 proteins) Pfam PF04077 |
![]() | Protein Hypothetical protein TM0979 [117490] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [117491] (2 PDB entries) Uniprot Q9X074 |
![]() | Domain d1rhxa_: 1rhx A: [111805] Structural genomics target |
PDB Entry: 1rhx (more details)
SCOPe Domain Sequences for d1rhxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rhxa_ c.114.1.2 (A:) Hypothetical protein TM0979 {Thermotoga maritima [TaxId: 2336]} malvlvkygtdhpveklkirsakaedkivliqngvfwaleeletpakvyaikddflargy seedskvplitysefidllegeekfig
Timeline for d1rhxa_: