Lineage for d1rfyb_ (1rfy B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979497Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1980254Superfamily a.2.13: Transcriptional repressor TraM [109631] (1 family) (S)
    similar structure to L29p (46561); contains extra short helix; forms homodimer: an open bundle
    automatically mapped to Pfam PF09228
  5. 1980255Family a.2.13.1: Transcriptional repressor TraM [109632] (2 protein domains)
  6. 1980256Protein Transcriptional repressor TraM [109633] (1 species)
  7. 1980257Species Agrobacterium tumefaciens [TaxId:358] [109634] (3 PDB entries)
    Uniprot Q57471
  8. 1980259Domain d1rfyb_: 1rfy B: [111799]

Details for d1rfyb_

PDB Entry: 1rfy (more details), 1.6 Å

PDB Description: Crystal Structure of Quorum-Sensing Antiactivator TraM
PDB Compounds: (B:) transcriptional repressor tram

SCOPe Domain Sequences for d1rfyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rfyb_ a.2.13.1 (B:) Transcriptional repressor TraM {Agrobacterium tumefaciens [TaxId: 358]}
velrpligltrglpptdletitidairthrrlvekadelfqalpetyktgqacggpqhir
yieasiemhaqmsalntlisilgfipkv

SCOPe Domain Coordinates for d1rfyb_:

Click to download the PDB-style file with coordinates for d1rfyb_.
(The format of our PDB-style files is described here.)

Timeline for d1rfyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rfya_