Lineage for d1rfya_ (1rfy A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1718782Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1719522Superfamily a.2.13: Transcriptional repressor TraM [109631] (1 family) (S)
    similar structure to L29p (46561); contains extra short helix; forms homodimer: an open bundle
    automatically mapped to Pfam PF09228
  5. 1719523Family a.2.13.1: Transcriptional repressor TraM [109632] (2 proteins)
  6. 1719524Protein Transcriptional repressor TraM [109633] (1 species)
  7. 1719525Species Agrobacterium tumefaciens [TaxId:358] [109634] (3 PDB entries)
    Uniprot Q57471
  8. 1719526Domain d1rfya_: 1rfy A: [111798]

Details for d1rfya_

PDB Entry: 1rfy (more details), 1.6 Å

PDB Description: crystal structure of quorum-sensing antiactivator tram
PDB Compounds: (A:) transcriptional repressor tram

SCOPe Domain Sequences for d1rfya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rfya_ a.2.13.1 (A:) Transcriptional repressor TraM {Agrobacterium tumefaciens [TaxId: 358]}
kkvelrpligltrglpptdletitidairthrrlvekadelfqalpetyktgqacggpqh
iryieasiemhaqmsalntlisilgfipk

SCOPe Domain Coordinates for d1rfya_:

Click to download the PDB-style file with coordinates for d1rfya_.
(The format of our PDB-style files is described here.)

Timeline for d1rfya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rfyb_