![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.13: Transcriptional repressor TraM [109631] (1 family) ![]() similar structure to L29p (46561); contains extra short helix; forms homodimer: an open bundle automatically mapped to Pfam PF09228 |
![]() | Family a.2.13.1: Transcriptional repressor TraM [109632] (2 proteins) |
![]() | Protein Transcriptional repressor TraM [109633] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [109634] (3 PDB entries) Uniprot Q57471 |
![]() | Domain d1rfya_: 1rfy A: [111798] |
PDB Entry: 1rfy (more details), 1.6 Å
SCOPe Domain Sequences for d1rfya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rfya_ a.2.13.1 (A:) Transcriptional repressor TraM {Agrobacterium tumefaciens [TaxId: 358]} kkvelrpligltrglpptdletitidairthrrlvekadelfqalpetyktgqacggpqh iryieasiemhaqmsalntlisilgfipk
Timeline for d1rfya_: