![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
![]() | Protein Hypothetical protein Rv2991 [117232] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [117233] (1 PDB entry) Uniprot O53240 |
![]() | Domain d1rfea_: 1rfe A: [111796] Structural genomics target |
PDB Entry: 1rfe (more details), 2 Å
SCOPe Domain Sequences for d1rfea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rfea_ b.45.1.1 (A:) Hypothetical protein Rv2991 {Mycobacterium tuberculosis [TaxId: 1773]} tkqradivmseaeiadfvnssrtgtlatigpdgqphltamwyavidgeiwletkaksqka vnlrrdprvsflledgdtydtlrgvsfegvaeiveepealhrvgvsvwerytgpytdeck pmvdqmmnkrvgvrivarrtrswdhrklglphmsvggsta
Timeline for d1rfea_: