Lineage for d1rfea_ (1rfe A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794134Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 2794203Protein Hypothetical protein Rv2991 [117232] (1 species)
  7. 2794204Species Mycobacterium tuberculosis [TaxId:1773] [117233] (1 PDB entry)
    Uniprot O53240
  8. 2794205Domain d1rfea_: 1rfe A: [111796]
    Structural genomics target

Details for d1rfea_

PDB Entry: 1rfe (more details), 2 Å

PDB Description: crystal structure of conserved hypothetical protein rv2991 from mycobacterium tuberculosis
PDB Compounds: (A:) hypothetical protein Rv2991

SCOPe Domain Sequences for d1rfea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rfea_ b.45.1.1 (A:) Hypothetical protein Rv2991 {Mycobacterium tuberculosis [TaxId: 1773]}
tkqradivmseaeiadfvnssrtgtlatigpdgqphltamwyavidgeiwletkaksqka
vnlrrdprvsflledgdtydtlrgvsfegvaeiveepealhrvgvsvwerytgpytdeck
pmvdqmmnkrvgvrivarrtrswdhrklglphmsvggsta

SCOPe Domain Coordinates for d1rfea_:

Click to download the PDB-style file with coordinates for d1rfea_.
(The format of our PDB-style files is described here.)

Timeline for d1rfea_: