Lineage for d1rf9a_ (1rf9 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646332Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 646333Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 646334Family a.104.1.1: Cytochrome P450 [48265] (21 proteins)
  6. 646437Protein Cytochrome P450-CAM [48266] (1 species)
  7. 646438Species Pseudomonas putida [TaxId:303] [48267] (57 PDB entries)
  8. 646513Domain d1rf9a_: 1rf9 A: [111795]
    complexed with dbr, egl, hem

Details for d1rf9a_

PDB Entry: 1rf9 (more details), 8 Å

PDB Description: crystal structure of cytochrome p450-cam with a fluorescent probe d-4- ad (adamantane-1-carboxylic acid-5-dimethylamino-naphthalene-1- sulfonylamino-butyl-amide)
PDB Compounds: (A:) Cytochrome P450-cam

SCOP Domain Sequences for d1rf9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rf9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
laplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgql
ireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenr
iqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgs
mtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggl
dtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhgv
qlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivt
lkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d1rf9a_:

Click to download the PDB-style file with coordinates for d1rf9a_.
(The format of our PDB-style files is described here.)

Timeline for d1rf9a_: