Lineage for d1rf2f_ (1rf2 F:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. Protein Cholera toxin [50208] (2 species)
    barrel, partly opened; n*=5, S*=10
  7. Species Vibrio cholerae [TaxId:666] [50209] (29 PDB entries)
    Uniprot P01556 22-124
  8. Domain d1rf2f_: 1rf2 F: [111792]
    complexed with bv4, pge, trs

Details for d1rf2f_

PDB Entry: 1rf2 (more details), 1.35 Å

PDB Description: Cholera Toxin B-Pentamer Complexed With Bivalent Nitrophenol-Galactoside Ligand BV4
PDB Compounds: (F:) cholera toxin B protein (CTB)

SCOPe Domain Sequences for d1rf2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rf2f_ b.40.2.1 (F:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d1rf2f_ are not available.

Timeline for d1rf2f_:

Domains from other chains:
(mouse over for more information)
d1rf2d_, d1rf2e_, d1rf2g_, d1rf2h_