![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
![]() | Protein Cytochrome P450-CAM [48266] (1 species) |
![]() | Species Pseudomonas putida [TaxId:303] [48267] (118 PDB entries) Uniprot P00183 |
![]() | Domain d1re9a_: 1re9 A: [111789] complexed with dso, edo, hem, k |
PDB Entry: 1re9 (more details), 1.45 Å
SCOPe Domain Sequences for d1re9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} laplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgql ireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenr iqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgs mtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggl dtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhgv qlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivt lkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
Timeline for d1re9a_: