Lineage for d1rdtd_ (1rdt D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543419Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 543420Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 543421Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 543605Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 543606Species Human (Homo sapiens) [TaxId:9606] [48525] (12 PDB entries)
  8. 543612Domain d1rdtd_: 1rdt D: [111788]
    Other proteins in same PDB: d1rdta_
    complexed with co-activator peptide
    complexed with 570, l79

Details for d1rdtd_

PDB Entry: 1rdt (more details), 2.4 Å

PDB Description: Crystal Structure of a new rexinoid bound to the RXRalpha ligand binding doamin in the RXRalpha/PPARgamma heterodimer

SCOP Domain Sequences for d1rdtd_:

Sequence, based on SEQRES records: (download)

>d1rdtd_ a.123.1.1 (D:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens)}
aesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
vtehvqllqvikktetdmslhpllqeiykdly

Sequence, based on observed residues (ATOM records): (download)

>d1rdtd_ a.123.1.1 (D:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens)}
aesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmevairifqg
cqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvliseg
qgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvk
piediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdms
lhpllqeiykdly

SCOP Domain Coordinates for d1rdtd_:

Click to download the PDB-style file with coordinates for d1rdtd_.
(The format of our PDB-style files is described here.)

Timeline for d1rdtd_: