Lineage for d1rdta_ (1rdt A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009236Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 2009237Species Human (Homo sapiens) [TaxId:9606] [48511] (34 PDB entries)
    Uniprot P19793 227-458
  8. 2009265Domain d1rdta_: 1rdt A: [111787]
    Other proteins in same PDB: d1rdtd1, d1rdtd2
    complexed with co-activator peptide
    complexed with 570, l79

Details for d1rdta_

PDB Entry: 1rdt (more details), 2.4 Å

PDB Description: Crystal Structure of a new rexinoid bound to the RXRalpha ligand binding doamin in the RXRalpha/PPARgamma heterodimer
PDB Compounds: (A:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d1rdta_:

Sequence, based on SEQRES records: (download)

>d1rdta_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
edmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakrip
hfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifd
rvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhk
ypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemle

Sequence, based on observed residues (ATOM records): (download)

>d1rdta_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
edmpverileaelavepdpvtnicqaadkqlftlvewakriphfselplddqvillragw
nelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdkt
elgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlpal
rsiglkclehlfffkligdtpidtflmemle

SCOPe Domain Coordinates for d1rdta_:

Click to download the PDB-style file with coordinates for d1rdta_.
(The format of our PDB-style files is described here.)

Timeline for d1rdta_: