Lineage for d1rdpf_ (1rdp F:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2381771Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2381772Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2381773Protein Cholera toxin [50208] (2 species)
    barrel, partly opened; n*=5, S*=10
  7. 2381780Species Vibrio cholerae [TaxId:666] [50209] (26 PDB entries)
    Uniprot P01556 22-124
  8. 2381793Domain d1rdpf_: 1rdp F: [111784]
    complexed with bv3, pge, trs

Details for d1rdpf_

PDB Entry: 1rdp (more details), 1.35 Å

PDB Description: Cholera Toxin B-Pentamer Complexed With Bivalent Nitrophenol-Galactoside Ligand BV3
PDB Compounds: (F:) cholera toxin B protein (CTB)

SCOPe Domain Sequences for d1rdpf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rdpf_ b.40.2.1 (F:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d1rdpf_:

Click to download the PDB-style file with coordinates for d1rdpf_.
(The format of our PDB-style files is described here.)

Timeline for d1rdpf_: