Lineage for d1rdpd_ (1rdp D:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 667366Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 667367Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 667368Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 667369Species Vibrio cholerae [TaxId:666] [50209] (23 PDB entries)
  8. 667385Domain d1rdpd_: 1rdp D: [111782]

Details for d1rdpd_

PDB Entry: 1rdp (more details), 1.35 Å

PDB Description: Cholera Toxin B-Pentamer Complexed With Bivalent Nitrophenol-Galactoside Ligand BV3
PDB Compounds: (D:) cholera toxin B protein (CTB)

SCOP Domain Sequences for d1rdpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rdpd_ b.40.2.1 (D:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOP Domain Coordinates for d1rdpd_:

Click to download the PDB-style file with coordinates for d1rdpd_.
(The format of our PDB-style files is described here.)

Timeline for d1rdpd_: