Lineage for d1rd9h_ (1rd9 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788204Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2788205Protein Cholera toxin [50208] (2 species)
    barrel, partly opened; n*=5, S*=10
  7. 2788212Species Vibrio cholerae [TaxId:666] [50209] (29 PDB entries)
    Uniprot P01556 22-124
  8. 2788242Domain d1rd9h_: 1rd9 H: [111781]
    complexed with bv2, p6g, trs

Details for d1rd9h_

PDB Entry: 1rd9 (more details), 1.44 Å

PDB Description: Cholera Toxin B-Pentamer Complexed With Bivalent Nitrophenol-Galactoside Ligand BV2
PDB Compounds: (H:) cholera toxin B protein (CTB)

SCOPe Domain Sequences for d1rd9h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rd9h_ b.40.2.1 (H:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d1rd9h_:

Click to download the PDB-style file with coordinates for d1rd9h_.
(The format of our PDB-style files is described here.)

Timeline for d1rd9h_: