Lineage for d1rd6a3 (1rd6 A:444-516)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601019Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 601184Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 601185Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 601204Protein Chitinase A [54558] (1 species)
  7. 601205Species Serratia marcescens [TaxId:615] [54559] (9 PDB entries)
  8. 601214Domain d1rd6a3: 1rd6 A:444-516 [111776]
    Other proteins in same PDB: d1rd6a1, d1rd6a2
    mutant

Details for d1rd6a3

PDB Entry: 1rd6 (more details), 2.6 Å

PDB Description: Crystal Structure of S. Marcescens Chitinase A Mutant W167A
PDB Compounds: (A:)

SCOP Domain Sequences for d1rd6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rd6a3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens}
ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiasqfmsgewqytydataeapy
vfkpstgdlitfd

SCOP Domain Coordinates for d1rd6a3:

Click to download the PDB-style file with coordinates for d1rd6a3.
(The format of our PDB-style files is described here.)

Timeline for d1rd6a3: