![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Chitinase A, N-terminal domain N [49233] (1 species) precedes the catalytic (beta/alpha)8-barrel domain |
![]() | Species Serratia marcescens [TaxId:615] [49234] (11 PDB entries) Uniprot P07254 24-563 |
![]() | Domain d1rd6a1: 1rd6 A:24-132 [111774] Other proteins in same PDB: d1rd6a2, d1rd6a3 mutant |
PDB Entry: 1rd6 (more details), 2.6 Å
SCOPe Domain Sequences for d1rd6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rd6a1 b.1.18.2 (A:24-132) Chitinase A, N-terminal domain N {Serratia marcescens [TaxId: 615]} aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdagttakillng keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad
Timeline for d1rd6a1: