Lineage for d1rcvh_ (1rcv H:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559069Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 559070Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 559071Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 559072Species Vibrio cholerae [TaxId:666] [50209] (23 PDB entries)
  8. 559122Domain d1rcvh_: 1rcv H: [111771]
    complexed with bv1

Details for d1rcvh_

PDB Entry: 1rcv (more details), 1.6 Å

PDB Description: Cholera Toxin B-Pentamer Complexed With Bivalent Nitrophenol-Galactoside Ligand BV1

SCOP Domain Sequences for d1rcvh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcvh_ b.40.2.1 (H:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOP Domain Coordinates for d1rcvh_:

Click to download the PDB-style file with coordinates for d1rcvh_.
(The format of our PDB-style files is described here.)

Timeline for d1rcvh_: