SCOP 1.71: Domain d1rc9a2: 1rc9 A:165-221

Lineage for d1rc9a2 (1rc9 A:165-221)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.19: Crisp domain-like [57545] (1 superfamily)
   disulfide-rich all-alpha fold

4. Superfamily g.19.1: Crisp domain-like [57546] (2 families)

5. Family g.19.1.2: Crisp domain [118259] (1 protein)
   Pfam 08562; contains extra N-terminal knottin-like subdomain

6. Protein Cysteine-rich secretory protein (SteCRISP) [118260] (1 species)

7. Species Chinese green tree viper (Trimeresurus stejnegeri) [TaxId:39682] [118261] (1 PDB entry)

8. Domain d1rc9a2: 1rc9 A:165-221 [111766]
   Other proteins in same PDB: d1rc9a1

Details for d1rc9a2

PDB Entry: 1rc9, 1.6 Å

PDB Description: crystal structure of stecrisp, a member of crisp family from trimeresurus stejnegeri refined at 1.6 angstroms resolution: structual relationship of the two domains

SCOP Domain Sequences for d1rc9a2:

Sequence; same for both SEQRES and ATOM records:

>d1rc9a2 g.19.1.2 (A:165-221) Cysteine-rich secretory protein (SteCRISP) {Chinese green tree viper (Trimeresurus stejnegeri)}
tpcgdcpsdcdnglctnpctrenkftncntmvqqsscqdnymktncpascfcqnkii

Timeline for d1rc9a2:

• d1rc9a2 is new in SCOP 1.71
  
• d1rc9a2 appears in SCOP 1.73
  
• d1rc9a2 appears in the current release, SCOPe 2.08