Lineage for d1rc9a2 (1rc9 A:165-221)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034336Fold g.19: Crisp domain-like [57545] (1 superfamily)
    disulfide-rich all-alpha fold
  4. 3034337Superfamily g.19.1: Crisp domain-like [57546] (3 families) (S)
  5. 3034346Family g.19.1.2: Crisp domain [118259] (1 protein)
    Pfam PF08562; contains extra N-terminal knottin-like subdomain
  6. 3034347Protein Cysteine-rich secretory protein (SteCRISP) [118260] (1 species)
  7. 3034348Species Chinese green tree viper (Trimeresurus stejnegeri) [TaxId:39682] [118261] (1 PDB entry)
    Uniprot P60623 13-233
  8. 3034349Domain d1rc9a2: 1rc9 A:165-221 [111766]
    Other proteins in same PDB: d1rc9a1

Details for d1rc9a2

PDB Entry: 1rc9 (more details), 1.6 Å

PDB Description: crystal structure of stecrisp, a member of crisp family from trimeresurus stejnegeri refined at 1.6 angstroms resolution: structual relationship of the two domains
PDB Compounds: (A:) cysteine-rich secretory protein

SCOPe Domain Sequences for d1rc9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rc9a2 g.19.1.2 (A:165-221) Cysteine-rich secretory protein (SteCRISP) {Chinese green tree viper (Trimeresurus stejnegeri) [TaxId: 39682]}
tpcgdcpsdcdnglctnpctrenkftncntmvqqsscqdnymktncpascfcqnkii

SCOPe Domain Coordinates for d1rc9a2:

Click to download the PDB-style file with coordinates for d1rc9a2.
(The format of our PDB-style files is described here.)

Timeline for d1rc9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rc9a1