![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.111: PR-1-like [55796] (1 superfamily) alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342 |
![]() | Superfamily d.111.1: PR-1-like [55797] (2 families) ![]() |
![]() | Family d.111.1.1: PR-1-like [55798] (5 proteins) Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1 |
![]() | Protein Cysteine-rich secretory protein (SteCRISP) [118079] (1 species) |
![]() | Species Chinese green tree viper (Trimeresurus stejnegeri) [TaxId:39682] [118080] (1 PDB entry) Uniprot P60623 13-233 |
![]() | Domain d1rc9a1: 1rc9 A:1-164 [111765] Other proteins in same PDB: d1rc9a2 |
PDB Entry: 1rc9 (more details), 1.6 Å
SCOPe Domain Sequences for d1rc9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rc9a1 d.111.1.1 (A:1-164) Cysteine-rich secretory protein (SteCRISP) {Chinese green tree viper (Trimeresurus stejnegeri) [TaxId: 39682]} nvdfdsesprkpeiqneivdlhnslrrsvnptasnmlrmewypeaadnaerwayrciesh ssyesrviegikcgeniymspypmkwtdiihawhdeykdfkygvgadppnavtghytqiv wyksyrigcaaaycpsspysyffvcqycpagnfigktatpytsg
Timeline for d1rc9a1: