Lineage for d1rc9a1 (1rc9 A:1-164)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535431Fold d.111: PR-1-like [55796] (1 superfamily)
    alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342
  4. 2535432Superfamily d.111.1: PR-1-like [55797] (2 families) (S)
  5. 2535433Family d.111.1.1: PR-1-like [55798] (5 proteins)
    Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1
  6. 2535434Protein Cysteine-rich secretory protein (SteCRISP) [118079] (1 species)
  7. 2535435Species Chinese green tree viper (Trimeresurus stejnegeri) [TaxId:39682] [118080] (1 PDB entry)
    Uniprot P60623 13-233
  8. 2535436Domain d1rc9a1: 1rc9 A:1-164 [111765]
    Other proteins in same PDB: d1rc9a2

Details for d1rc9a1

PDB Entry: 1rc9 (more details), 1.6 Å

PDB Description: crystal structure of stecrisp, a member of crisp family from trimeresurus stejnegeri refined at 1.6 angstroms resolution: structual relationship of the two domains
PDB Compounds: (A:) cysteine-rich secretory protein

SCOPe Domain Sequences for d1rc9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rc9a1 d.111.1.1 (A:1-164) Cysteine-rich secretory protein (SteCRISP) {Chinese green tree viper (Trimeresurus stejnegeri) [TaxId: 39682]}
nvdfdsesprkpeiqneivdlhnslrrsvnptasnmlrmewypeaadnaerwayrciesh
ssyesrviegikcgeniymspypmkwtdiihawhdeykdfkygvgadppnavtghytqiv
wyksyrigcaaaycpsspysyffvcqycpagnfigktatpytsg

SCOPe Domain Coordinates for d1rc9a1:

Click to download the PDB-style file with coordinates for d1rc9a1.
(The format of our PDB-style files is described here.)

Timeline for d1rc9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rc9a2