Lineage for d1rb0a_ (1rb0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954945Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) (S)
    common fold is elaborated with additional secondary structures
    automatically mapped to Pfam PF01288
  5. 2954946Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein)
  6. 2954947Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (4 species)
  7. 2954962Species Escherichia coli [TaxId:562] [55086] (49 PDB entries)
    Uniprot P26281
  8. 2954975Domain d1rb0a_: 1rb0 A: [111764]
    complexed with hh2

Details for d1rb0a_

PDB Entry: 1rb0 (more details), 1.35 Å

PDB Description: crystal structure of a binary complex of e. coli hppk with 6-hydroxymethylpterin-diphosphate at 1.35 angstrom resolution
PDB Compounds: (A:) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase

SCOPe Domain Sequences for d1rb0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rb0a_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli [TaxId: 562]}
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

SCOPe Domain Coordinates for d1rb0a_:

Click to download the PDB-style file with coordinates for d1rb0a_.
(The format of our PDB-style files is described here.)

Timeline for d1rb0a_: