Lineage for d1raka1 (1rak A:4-55,A:376-426)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568555Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 568556Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 568597Family b.92.1.2: Cytosine deaminase [69373] (1 protein)
  6. 568598Protein Cytosine deaminase [69374] (1 species)
  7. 568599Species Escherichia coli [TaxId:562] [69375] (8 PDB entries)
  8. 568602Domain d1raka1: 1rak A:4-55,A:376-426 [111761]
    Other proteins in same PDB: d1raka2
    complexed with fe, fpy, gol; mutant

Details for d1raka1

PDB Entry: 1rak (more details), 1.32 Å

PDB Description: Bacterial cytosine deaminase D314S mutant bound to 5-fluoro-4-(S)-hydroxyl-3,4-dihydropyrimidine.

SCOP Domain Sequences for d1raka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1raka1 b.92.1.2 (A:4-55,A:376-426) Cytosine deaminase {Escherichia coli}
alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipXliilpae
ngfdalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr

SCOP Domain Coordinates for d1raka1:

Click to download the PDB-style file with coordinates for d1raka1.
(The format of our PDB-style files is described here.)

Timeline for d1raka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1raka2