![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.5: Cytosine deaminase catalytic domain [69390] (1 protein) automatically mapped to Pfam PF13147 automatically mapped to Pfam PF07969 |
![]() | Protein Cytosine deaminase catalytic domain [69391] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [69392] (8 PDB entries) Uniprot P25524 |
![]() | Domain d1ra0a2: 1ra0 A:56-375 [111757] Other proteins in same PDB: d1ra0a1 complexed with fe, fpy; mutant |
PDB Entry: 1ra0 (more details), 1.12 Å
SCOPe Domain Sequences for d1ra0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ra0a2 c.1.9.5 (A:56-375) Cytosine deaminase catalytic domain {Escherichia coli [TaxId: 562]} pfvephihldttqtagqpnwnqsgtlfegierwaerkallthddvkqrawqtlkwqiang iqhvrthvdvsdatltalkamlevkqevapwidlqivafpqegilsypngealleealrl gadvvgaiphfeftreygveslhktfalaqkydrlidvhcdeiddeqsrfvetvaalahh egmgarvtashttamhsyngaytsrlfrllkmsginfvanplvnihlqgrfdtypkrrgi trvkemlesginvcfghdgvfdpwyplgtanmlqvlhmglhvcqlmgygqindglnlith hsartlnlqdygiaagnsan
Timeline for d1ra0a2: